Lineage for d1i4fa2 (1i4f A:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897312Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries)
    Uniprot P01892 25-298
  8. 1897313Domain d1i4fa2: 1i4f A:1-181 [61688]
    Other proteins in same PDB: d1i4fa1, d1i4fb_
    complexed with 1pg

Details for d1i4fa2

PDB Entry: 1i4f (more details), 1.4 Å

PDB Description: crystal structure of hla-a*0201/mage-a4-peptide complex
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d1i4fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4fa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1i4fa2:

Click to download the PDB-style file with coordinates for d1i4fa2.
(The format of our PDB-style files is described here.)

Timeline for d1i4fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4fa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1i4fb_