Lineage for d1i4fa2 (1i4f A:1-181)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190321Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 190330Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (27 PDB entries)
  8. 190331Domain d1i4fa2: 1i4f A:1-181 [61688]
    Other proteins in same PDB: d1i4fa1, d1i4fb1

Details for d1i4fa2

PDB Entry: 1i4f (more details), 1.4 Å

PDB Description: crystal structure of hla-a*0201/mage-a4-peptide complex

SCOP Domain Sequences for d1i4fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4fa2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1i4fa2:

Click to download the PDB-style file with coordinates for d1i4fa2.
(The format of our PDB-style files is described here.)

Timeline for d1i4fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4fa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1i4fb1