Lineage for d1i4db_ (1i4d B:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 432009Fold h.4: Antiparallel coiled-coil [58086] (15 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 432062Superfamily h.4.7: Arfaptin, Rac-binding fragment [64598] (1 family) (S)
  5. 432063Family h.4.7.1: Arfaptin, Rac-binding fragment [64599] (1 protein)
  6. 432064Protein Arfaptin, Rac-binding fragment [64600] (1 species)
    active form is a dimer
  7. 432065Species Human (Homo sapiens) [TaxId:9606] [64601] (4 PDB entries)
  8. 432067Domain d1i4db_: 1i4d B: [61683]
    Other proteins in same PDB: d1i4dd_
    complexed with gdp, mg

Details for d1i4db_

PDB Entry: 1i4d (more details), 2.5 Å

PDB Description: crystal structure analysis of rac1-gdp complexed with arfaptin (p21)

SCOP Domain Sequences for d1i4db_:

Sequence, based on SEQRES records: (download)

>d1i4db_ h.4.7.1 (B:) Arfaptin, Rac-binding fragment {Human (Homo sapiens)}
vdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelqee
fgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayrtd
leelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkqlllf
hnavsayfagnqkqleqtlq

Sequence, based on observed residues (ATOM records): (download)

>d1i4db_ h.4.7.1 (B:) Arfaptin, Rac-binding fragment {Human (Homo sapiens)}
vdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelqee
fgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayrtd
leesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkqlllfhnavsayfagnqkql
eqtlq

SCOP Domain Coordinates for d1i4db_:

Click to download the PDB-style file with coordinates for d1i4db_.
(The format of our PDB-style files is described here.)

Timeline for d1i4db_: