Class a: All alpha proteins [46456] (290 folds) |
Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
Family a.238.1.2: Arfaptin, Rac-binding fragment [64599] (2 proteins) automatically mapped to Pfam PF06456 |
Protein Arfaptin, Rac-binding fragment [64600] (1 species) active form is a dimer |
Species Human (Homo sapiens) [TaxId:9606] [64601] (4 PDB entries) |
Domain d1i4db_: 1i4d B: [61683] Other proteins in same PDB: d1i4dd_ complexed with gdp, mg |
PDB Entry: 1i4d (more details), 2.5 Å
SCOPe Domain Sequences for d1i4db_:
Sequence, based on SEQRES records: (download)
>d1i4db_ a.238.1.2 (B:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} vdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelqee fgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayrtd leelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkqlllf hnavsayfagnqkqleqtlq
>d1i4db_ a.238.1.2 (B:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} vdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelqee fgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayrtd leesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkqlllfhnavsayfagnqkql eqtlq
Timeline for d1i4db_: