Lineage for d1i4da_ (1i4d A:)

  1. Root: SCOP 1.57
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.4: Antiparallel coiled-coil [58086] (8 superfamilies)
  4. Superfamily h.4.7: Arfaptin, Rac-binding fragment [64598] (1 family) (S)
  5. Family h.4.7.1: Arfaptin, Rac-binding fragment [64599] (1 protein)
  6. Protein Arfaptin, Rac-binding fragment [64600] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [64601] (4 PDB entries)
  8. Domain d1i4da_: 1i4d A: [61682]
    Other proteins in same PDB: d1i4dd_

Details for d1i4da_

PDB Entry: 1i4d (more details), 2.5 Å

PDB Description: crystal structure analysis of rac1-gdp complexed with arfaptin (p21)

SCOP Domain Sequences for d1i4da_:

Sequence, based on SEQRES records: (download)

>d1i4da_ h.4.7.1 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens)}
srtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspel
qeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyday
rtdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkql
llfhnavsayfagnqkqleq

Sequence, based on observed residues (ATOM records): (download)

>d1i4da_ h.4.7.1 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens)}
srtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspel
qeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyday
rtdleelsesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkqlllfhnavsayfa
gnqkqleq

SCOP Domain Coordinates for d1i4da_ are not available.

Timeline for d1i4da_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i4db_, d1i4dd_