Lineage for d1i49b_ (1i49 B:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 206141Fold h.4: Antiparallel coiled-coil [58086] (12 superfamilies)
  4. 206184Superfamily h.4.7: Arfaptin, Rac-binding fragment [64598] (1 family) (S)
  5. 206185Family h.4.7.1: Arfaptin, Rac-binding fragment [64599] (1 protein)
  6. 206186Protein Arfaptin, Rac-binding fragment [64600] (1 species)
  7. 206187Species Human (Homo sapiens) [TaxId:9606] [64601] (4 PDB entries)
  8. 206193Domain d1i49b_: 1i49 B: [61680]

Details for d1i49b_

PDB Entry: 1i49 (more details), 2.8 Å

PDB Description: crystal structure analysis of arfaptin

SCOP Domain Sequences for d1i49b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i49b_ h.4.7.1 (B:) Arfaptin, Rac-binding fragment {Human (Homo sapiens)}
srtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspel
qeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyday
rtdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkql
llfhnavsayfagnqkqleqt

SCOP Domain Coordinates for d1i49b_:

Click to download the PDB-style file with coordinates for d1i49b_.
(The format of our PDB-style files is described here.)

Timeline for d1i49b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i49a_