Lineage for d1i48k_ (1i48 K:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147545Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2147607Protein Cystathionine gamma-synthase, CGS [53405] (2 species)
  7. 2147613Species Tobacco (Nicotiana tabacum) [TaxId:4097] [53407] (4 PDB entries)
  8. 2147656Domain d1i48k_: 1i48 K: [61677]
    complexed with cco, plp

Details for d1i48k_

PDB Entry: 1i48 (more details), 3.25 Å

PDB Description: cystathionine gamma-synthase in complex with the inhibitor ctcpo
PDB Compounds: (K:) cystathionine gamma-synthase

SCOPe Domain Sequences for d1i48k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i48k_ c.67.1.3 (K:) Cystathionine gamma-synthase, CGS {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
yasflnsdgsvaihagerlgrgivtdaittpvvntsayffnktselidfkekrrasfeyg
rygnpttvvleekisalegaestllmasgmcastvmllalvpagghivtttdcyrktrif
ietilpkmgitatvidpadvgalelalnqkkvnlfftesptnpflrcvdielvsklchek
galvcidgtfatplnqkalalgadlvlhsatkflgghndvlagcisgplklvseirnlhh
ilggalnpnaayliirgmktlhlrvqqqnstalrmaeileahpkvrhvyypglqshpehh
iakkqmtgfggavsfevdgdllttakfvdalkipyiapsfggcesivdqpaimsywdlsq
sdrakygimdnlvrfsfgvedfddlkadilqaldsi

SCOPe Domain Coordinates for d1i48k_:

Click to download the PDB-style file with coordinates for d1i48k_.
(The format of our PDB-style files is described here.)

Timeline for d1i48k_: