Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein Cystathionine gamma-synthase, CGS [53405] (2 species) |
Species Tobacco (Nicotiana tabacum) [TaxId:4097] [53407] (4 PDB entries) |
Domain d1i41g_: 1i41 G: [61645] complexed with hen |
PDB Entry: 1i41 (more details), 3.2 Å
SCOPe Domain Sequences for d1i41g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i41g_ c.67.1.3 (G:) Cystathionine gamma-synthase, CGS {Tobacco (Nicotiana tabacum) [TaxId: 4097]} yasflnsdgsvaihagerlgrgivtdaittpvvntsayffnktselidfkekrrasfeyg rygnpttvvleekisalegaestllmasgmcastvmllalvpagghivtttdcyrktrif ietilpkmgitatvidpadvgalelalnqkkvnlfftesptnpflrcvdielvsklchek galvcidgtfatplnqkalalgadlvlhsatkflgghndvlagcisgplklvseirnlhh ilggalnpnaayliirgmktlhlrvqqqnstalrmaeileahpkvrhvyypglqshpehh iakkqmtgfggavsfevdgdllttakfvdalkipyiapsfggcesivdqpaimsywdlsq sdrakygimdnlvrfsfgvedfddlkadilqaldsi
Timeline for d1i41g_: