SCOPe 2.01: Domain d1i3vb_: 1i3v B:

Lineage for d1i3vb_ (1i3v B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Llama (Lama glama) [TaxId:9844] [88565] (8 PDB entries)

8. Domain d1i3vb_: 1i3v B: [61638]
   dye RR1-binding VHh domain

Details for d1i3vb_

PDB Entry: 1i3v, 2.03 Å

PDB Description: three-dimensional structure of a lama vhh domain unliganded

PDB Compounds: (B:) antibody vhh lama domain

SCOPe Domain Sequences for d1i3vb_:

Sequence; same for both SEQRES and ATOM records:

>d1i3vb_ b.1.1.1 (B:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsd
fytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywg
qgtqvtvss

Timeline for d1i3vb_:

• d1i3vb_ first appeared in SCOP 1.57
  
• d1i3vb_ appears in SCOP 1.75
  
• d1i3vb_ appears in SCOPe 2.02
  
• d1i3vb_ appears in the current release, SCOPe 2.08, called d1i3vb1