SCOP 1.59: Domain d1i3va_: 1i3v A:

Lineage for d1i3va_ (1i3v A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Llama (Lama glama), the dye RR1-binding VHh domain [63649] (2 PDB entries)

8. Domain d1i3va_: 1i3v A: [61637]

Details for d1i3va_

PDB Entry: 1i3v, 2.03 Å

PDB Description: three-dimensional structure of a lama vhh domain unliganded

SCOP Domain Sequences for d1i3va_:

Sequence; same for both SEQRES and ATOM records:

>d1i3va_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Llama (Lama glama), the dye RR1-binding VHh domain}
qvqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsd
fytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywg
qgtqvtvss

Timeline for d1i3va_:

• d1i3va_ first appeared in SCOP 1.57
  
• d1i3va_ appears in SCOP 1.61
  
• d1i3va_ appears in the current release, SCOPe 2.08, called d1i3va1