Lineage for d1i3ua_ (1i3u A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287449Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 1287487Species Llama (Lama glama) [TaxId:9844] [88565] (8 PDB entries)
  8. 1287490Domain d1i3ua_: 1i3u A: [61636]
    dye RR1-binding VHh domain
    complexed with rr1, so4

Details for d1i3ua_

PDB Entry: 1i3u (more details), 1.95 Å

PDB Description: three-dimensional structure of a llama vhh domain complexed with the dye rr1
PDB Compounds: (A:) antibody vhh lama domain

SCOPe Domain Sequences for d1i3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
xvqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsd
fytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywg
qgtqvtv

SCOPe Domain Coordinates for d1i3ua_:

Click to download the PDB-style file with coordinates for d1i3ua_.
(The format of our PDB-style files is described here.)

Timeline for d1i3ua_: