| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
| Species Llama (Lama glama) [TaxId:9844] [88565] (8 PDB entries) |
| Domain d1i3ua_: 1i3u A: [61636] dye RR1-binding VHh domain complexed with rr1, so4 |
PDB Entry: 1i3u (more details), 1.95 Å
SCOPe Domain Sequences for d1i3ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
xvqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsd
fytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywg
qgtqvtv
Timeline for d1i3ua_: