Lineage for d1i3ua_ (1i3u A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52708Species Llama (Lama glama), the dye RR1-binding VHh domain [63649] (2 PDB entries)
  8. 52709Domain d1i3ua_: 1i3u A: [61636]

Details for d1i3ua_

PDB Entry: 1i3u (more details), 1.95 Å

PDB Description: three-dimensional structure of a llama vhh domain complexed with the dye rr1

SCOP Domain Sequences for d1i3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3ua_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Llama (Lama glama), the dye RR1-binding VHh domain}
vqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsdf
ytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywgq
gtqvtv

SCOP Domain Coordinates for d1i3ua_:

Click to download the PDB-style file with coordinates for d1i3ua_.
(The format of our PDB-style files is described here.)

Timeline for d1i3ua_: