SCOP 1.57: Domain d1i3ua_: 1i3u A:

Lineage for d1i3ua_ (1i3u A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Llama (Lama glama), the dye RR1-binding VHh domain [63649] (2 PDB entries)

8. Domain d1i3ua_: 1i3u A: [61636]

Details for d1i3ua_

PDB Entry: 1i3u, 1.95 Å

PDB Description: three-dimensional structure of a llama vhh domain complexed with the dye rr1

SCOP Domain Sequences for d1i3ua_:

Sequence; same for both SEQRES and ATOM records:

>d1i3ua_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Llama (Lama glama), the dye RR1-binding VHh domain}
vqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsdf
ytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywgq
gtqvtv

Timeline for d1i3ua_:

• d1i3ua_ is new in SCOP 1.57
  
• d1i3ua_ appears in SCOP 1.59
  
• d1i3ua_ appears in the current release, SCOPe 2.08