Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (10 PDB entries) |
Domain d1i3rh2: 1i3r H:1-120 [61635] Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb1, d1i3rc1, d1i3rc2, d1i3rd1, d1i3re1, d1i3re2, d1i3rf1, d1i3rg1, d1i3rg2, d1i3rh1 contains covalently bound peptides at the N-termini of chains B, D, F and H complexed with nag; mutant fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1i3r (more details), 2.4 Å
SCOPe Domain Sequences for d1i3rh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3rh2 d.19.1.1 (H:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]} gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
Timeline for d1i3rh2: