Lineage for d1i3rf2 (1i3r F:1-120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938478Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (10 PDB entries)
  8. 2938489Domain d1i3rf2: 1i3r F:1-120 [61631]
    Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb1, d1i3rc1, d1i3rc2, d1i3rd1, d1i3re1, d1i3re2, d1i3rf1, d1i3rg1, d1i3rg2, d1i3rh1
    contains covalently bound peptides at the N-termini of chains B, D, F and H
    complexed with nag; mutant

    fragment; missing more than one-third of the common structure and/or sequence

Details for d1i3rf2

PDB Entry: 1i3r (more details), 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule
PDB Compounds: (F:) fusion protein consisting of MHC e-beta-k precursor, glycine rich linker, and hemoglobin beta-2 chain

SCOPe Domain Sequences for d1i3rf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3rf2 d.19.1.1 (F:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr

SCOPe Domain Coordinates for d1i3rf2:

Click to download the PDB-style file with coordinates for d1i3rf2.
(The format of our PDB-style files is described here.)

Timeline for d1i3rf2: