Lineage for d1i3rd2 (1i3r D:1-120)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406673Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1406781Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries)
  8. 1406791Domain d1i3rd2: 1i3r D:1-120 [61627]
    Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb1, d1i3rc1, d1i3rc2, d1i3rd1, d1i3re1, d1i3re2, d1i3rf1, d1i3rg1, d1i3rg2, d1i3rh1
    contains covalently bound peptides at the N-termini of chains B, D, F and H
    complexed with nag, ndg; mutant

Details for d1i3rd2

PDB Entry: 1i3r (more details), 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule
PDB Compounds: (D:) fusion protein consisting of MHC e-beta-k precursor, glycine rich linker, and hemoglobin beta-2 chain

SCOPe Domain Sequences for d1i3rd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3rd2 d.19.1.1 (D:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr

SCOPe Domain Coordinates for d1i3rd2:

Click to download the PDB-style file with coordinates for d1i3rd2.
(The format of our PDB-style files is described here.)

Timeline for d1i3rd2: