SCOPe 2.08: Domain d1i3rb2: 1i3r B:1-120

Lineage for d1i3rb2 (1i3r B:1-120)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (10 PDB entries)

8. Domain d1i3rb2: 1i3r B:1-120 [61623]
   Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb1, d1i3rc1, d1i3rc2, d1i3rd1, d1i3re1, d1i3re2, d1i3rf1, d1i3rg1, d1i3rg2, d1i3rh1
   contains covalently bound peptides at the N-termini of chains B, D, F and H
   complexed with nag; mutant
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1i3rb2

PDB Entry: 1i3r, 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule

PDB Compounds: (B:) fusion protein consisting of MHC e-beta-k precursor, glycine rich linker, and hemoglobin beta-2 chain

SCOPe Domain Sequences for d1i3rb2:

Sequence; same for both SEQRES and ATOM records:

>d1i3rb2 d.19.1.1 (B:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr

Timeline for d1i3rb2:

• d1i3rb2 first appeared in SCOP 1.57
  
• d1i3rb2 appears in SCOPe 2.07