SCOPe 2.08: Domain d1i3rb1: 1i3r B:121-216

Lineage for d1i3rb1 (1i3r B:121-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d1i3rb1: 1i3r B:121-216 [61622]
   Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb2, d1i3rc1, d1i3rc2, d1i3rd2, d1i3re1, d1i3re2, d1i3rf2, d1i3rg1, d1i3rg2, d1i3rh2
   contains covalently bound peptides at the N-termini of chains B, D, F and H
   complexed with nag; mutant

Details for d1i3rb1

PDB Entry: 1i3r, 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule

PDB Compounds: (B:) fusion protein consisting of MHC e-beta-k precursor, glycine rich linker, and hemoglobin beta-2 chain

SCOPe Domain Sequences for d1i3rb1:

Sequence; same for both SEQRES and ATOM records:

>d1i3rb1 b.1.1.2 (B:121-216) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
fqtlvmletvpqsgevytcqvehpsltdpvtvewka

Timeline for d1i3rb1:

• d1i3rb1 first appeared in SCOP 1.57
  
• d1i3rb1 appears in SCOPe 2.07