Lineage for d1i3qk_ (1i3q K:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913462Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1913588Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 1913689Family d.74.3.2: RBP11/RpoL [64311] (3 proteins)
  6. 1913696Protein RPB11 [64312] (2 species)
  7. 1913697Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 1913701Domain d1i3qk_: 1i3q K: [61618]
    Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3ql_
    protein/RNA complex; complexed with mg, zn

Details for d1i3qk_

PDB Entry: 1i3q (more details), 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6kd polypeptide

SCOPe Domain Sequences for d1i3qk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3qk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d1i3qk_:

Click to download the PDB-style file with coordinates for d1i3qk_.
(The format of our PDB-style files is described here.)

Timeline for d1i3qk_: