Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.74: DCoH-like [55247] (4 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) form homo and heterodimers |
Family d.74.3.2: RPB11 [64311] (1 protein) |
Protein RPB11 [64312] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (4 PDB entries) |
Domain d1i3qk_: 1i3q K: [61618] Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3ql_ complexed with mg, zn |
PDB Entry: 1i3q (more details), 3.1 Å
SCOP Domain Sequences for d1i3qk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3qk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae)} mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d1i3qk_: