SCOP 1.65: Domain d1i3qk_: 1i3q K:

Lineage for d1i3qk_ (1i3q K:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.2: RPB11 [64311] (1 protein)

6. Protein RPB11 [64312] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (4 PDB entries)

8. Domain d1i3qk_: 1i3q K: [61618]
   Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3ql_
   complexed with mg, zn

Details for d1i3qk_

PDB Entry: 1i3q, 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution

SCOP Domain Sequences for d1i3qk_:

Sequence; same for both SEQRES and ATOM records:

>d1i3qk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae)}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

Timeline for d1i3qk_:

• d1i3qk_ first appeared in SCOP 1.57
  
• d1i3qk_ appears in SCOP 1.63
  
• d1i3qk_ appears in SCOP 1.67
  
• d1i3qk_ appears in the current release, SCOPe 2.08