Lineage for d1i3qk_ (1i3q K:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134642Fold d.74: DCoH-like [55247] (4 superfamilies)
  4. 134714Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
  5. 134731Family d.74.3.2: RPB11 [64311] (1 protein)
  6. 134732Protein RPB11 [64312] (1 species)
  7. 134733Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (4 PDB entries)
  8. 134736Domain d1i3qk_: 1i3q K: [61618]
    Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3ql_

Details for d1i3qk_

PDB Entry: 1i3q (more details), 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution
PDB Compounds: (K:)

SCOP Domain Sequences for d1i3qk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3qk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae)}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOP Domain Coordinates for d1i3qk_:

Click to download the PDB-style file with coordinates for d1i3qk_.
(The format of our PDB-style files is described here.)

Timeline for d1i3qk_: