Lineage for d1i3qk_ (1i3q K:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.74: DCoH-like [55247] (4 superfamilies) 
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) 
Family d.74.3.2: RPB11 [64311] (1 protein) Protein RPB11 [64312] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (3 PDB entries) 
Domain d1i3qk_: 1i3q K: [61618]
Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3ql_
Details for d1i3qk_
PDB Entry: 1i3q (more details), 3.1 Å
PDB Description: rna polymerase ii crystal form i at 3.1 a resolution
SCOP Domain Sequences for d1i3qk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3qk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae)}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
SCOP Domain Coordinates for d1i3qk_:
Click to download the PDB-style file with coordinates for d1i3qk_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i3qk_:
- d1i3qk_ is new in SCOP 1.57
- d1i3qk_ appears in SCOP 1.59
- d1i3qk_ appears in the current release, SCOPe 2.08
View in 3D
