Lineage for d1i3qj_ (1i3q J:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95614Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 95615Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
  6. 95616Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 95619Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (4 PDB entries)
  8. 95622Domain d1i3qj_: 1i3q J: [61617]
    Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qk_, d1i3ql_

Details for d1i3qj_

PDB Entry: 1i3q (more details), 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution
PDB Compounds: (J:)

SCOP Domain Sequences for d1i3qj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3qj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae)}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOP Domain Coordinates for d1i3qj_:

Click to download the PDB-style file with coordinates for d1i3qj_.
(The format of our PDB-style files is described here.)

Timeline for d1i3qj_: