Lineage for d1i3qi1 (1i3q I:1-49)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90495Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 90713Superfamily g.41.9: Zn-binding RNA polymerase subunits [63393] (2 families) (S)
  5. 90714Family g.41.9.1: RBP9 subunit of RNA polymerase II [63394] (1 protein)
  6. 90715Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
  7. 90718Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (3 PDB entries)
  8. 90721Domain d1i3qi1: 1i3q I:1-49 [61615]
    Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qj_, d1i3qk_, d1i3ql_

Details for d1i3qi1

PDB Entry: 1i3q (more details), 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution

SCOP Domain Sequences for d1i3qi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3qi1 g.41.9.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)}
mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOP Domain Coordinates for d1i3qi1:

Click to download the PDB-style file with coordinates for d1i3qi1.
(The format of our PDB-style files is described here.)

Timeline for d1i3qi1: