Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) |
Family d.78.1.2: RPB6 [55294] (1 protein) |
Protein RPB6 [55295] (2 species) essential subunit of RNA polymerases I, II and III |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (4 PDB entries) |
Domain d1i3qf_: 1i3q F: [61613] Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3qk_, d1i3ql_ complexed with mg, zn |
PDB Entry: 1i3q (more details), 3.1 Å
SCOP Domain Sequences for d1i3qf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3qf_ d.78.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae)} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivdl
Timeline for d1i3qf_: