Lineage for d1i3qe2 (1i3q E:144-215)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201058Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2201059Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2201060Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 2201061Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)
  7. 2201062Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (26 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2201067Domain d1i3qe2: 1i3q E:144-215 [61612]
    Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3qk_, d1i3ql_
    protein/RNA complex; complexed with mg, zn

Details for d1i3qe2

PDB Entry: 1i3q (more details), 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution
PDB Compounds: (E:) DNA-directed RNA polymerase II 27kd polypeptide

SCOPe Domain Sequences for d1i3qe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3qe2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d1i3qe2:

Click to download the PDB-style file with coordinates for d1i3qe2.
(The format of our PDB-style files is described here.)

Timeline for d1i3qe2: