Lineage for d1i3qe2 (1i3q E:144-215)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81380Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
  4. 81381Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
  5. 81382Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 81383Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 81384Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (4 PDB entries)
  8. 81387Domain d1i3qe2: 1i3q E:144-215 [61612]
    Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3qk_, d1i3ql_

Details for d1i3qe2

PDB Entry: 1i3q (more details), 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution
PDB Compounds: (E:)

SCOP Domain Sequences for d1i3qe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3qe2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOP Domain Coordinates for d1i3qe2:

Click to download the PDB-style file with coordinates for d1i3qe2.
(The format of our PDB-style files is described here.)

Timeline for d1i3qe2: