Lineage for d1i3qb_ (1i3q B:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 619101Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 619102Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 619103Family e.29.1.1: RNA-polymerase beta [64485] (2 proteins)
  6. 619104Protein RBP2 [64491] (1 species)
  7. 619105Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (9 PDB entries)
  8. 619109Domain d1i3qb_: 1i3q B: [61608]
    Other proteins in same PDB: d1i3qa_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3qk_, d1i3ql_
    complexed with mg, zn

Details for d1i3qb_

PDB Entry: 1i3q (more details), 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution
PDB Compounds: (B:)

SCOP Domain Sequences for d1i3qb_:

Sequence, based on SEQRES records: (download)

>d1i3qb_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae)}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsrdf

Sequence, based on observed residues (ATOM records): (download)

>d1i3qb_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae)}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlieisfgkiyv
tkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyekvfigrlpimlrskncyls
eatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirs
alekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehic
ydvndwqmlemlkpcvedgfviqdretaldfigkekriqyakdilqkeflphitqlegfe
srkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifry
mqrtvelainaktitsglkyalatgnwgagvsqvlnrytysstlshlrrtntpiakprql
hnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgmepledyvphqs
pdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirekelkiftdagrvy
rplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglveyidaeeeesili
amqpedlepdvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsprntyqsa
mgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaivaiacysg
ynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtntlrmkhgtydk
ldddgliapgvrvsgedviigkttpisskrdastplrstengivdqvlvttnqdglkfvk
vrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvah
liecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqi
ffgptyyqrlrhmvddkiharargpglrfgemerdcmiahgaasflkerlmeasdafrvh
icgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytdrs
rdf

SCOP Domain Coordinates for d1i3qb_:

Click to download the PDB-style file with coordinates for d1i3qb_.
(The format of our PDB-style files is described here.)

Timeline for d1i3qb_: