Lineage for d1i3mb_ (1i3m B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842869Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (4 species)
  7. 2842891Species Human (Homo sapiens) [TaxId:9606] [51754] (7 PDB entries)
  8. 2842895Domain d1i3mb_: 1i3m B: [61600]
    complexed with cl, mg, nad, ud1

Details for d1i3mb_

PDB Entry: 1i3m (more details), 1.5 Å

PDB Description: molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
PDB Compounds: (B:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d1i3mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3mb_ c.2.1.2 (B:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]}
aekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsve
feemdildqgalqrlfkkysfmavihfaglkamgesvqkpldyyrvnltgtiqlleimka
hgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwnvv
llryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrdy
ihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarre
gdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgt

SCOPe Domain Coordinates for d1i3mb_:

Click to download the PDB-style file with coordinates for d1i3mb_.
(The format of our PDB-style files is described here.)

Timeline for d1i3mb_: