SCOP 1.57: Domain d1i3ma_: 1i3m A:

Lineage for d1i3ma_ (1i3m A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins)

6. Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51754] (7 PDB entries)

8. Domain d1i3ma_: 1i3m A: [61599]

Details for d1i3ma_

PDB Entry: 1i3m, 1.5 Å

PDB Description: molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase

SCOP Domain Sequences for d1i3ma_:

Sequence; same for both SEQRES and ATOM records:

>d1i3ma_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens)}
aekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsve
feemdildqgalqrlfkkysfmavihfaglkamgesvqkpldyyrvnltgtiqlleimka
hgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwnvv
llryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrdy
ihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarre
gdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgtqa

Timeline for d1i3ma_:

• d1i3ma_ is new in SCOP 1.57
  
• d1i3ma_ appears in SCOP 1.59
  
• d1i3ma_ appears in the current release, SCOPe 2.08