Lineage for d1i3ma_ (1i3m A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66266Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins)
  6. 66516Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (2 species)
  7. 66533Species Human (Homo sapiens) [TaxId:9606] [51754] (7 PDB entries)
  8. 66544Domain d1i3ma_: 1i3m A: [61599]

Details for d1i3ma_

PDB Entry: 1i3m (more details), 1.5 Å

PDB Description: molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase

SCOP Domain Sequences for d1i3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3ma_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens)}
aekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsve
feemdildqgalqrlfkkysfmavihfaglkamgesvqkpldyyrvnltgtiqlleimka
hgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwnvv
llryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrdy
ihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarre
gdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgtqa

SCOP Domain Coordinates for d1i3ma_:

Click to download the PDB-style file with coordinates for d1i3ma_.
(The format of our PDB-style files is described here.)

Timeline for d1i3ma_: