Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [51754] (7 PDB entries) |
Domain d1i3kb_: 1i3k B: [61596] complexed with cl, edo, mg, nad, upg |
PDB Entry: 1i3k (more details), 1.5 Å
SCOPe Domain Sequences for d1i3kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3kb_ c.2.1.2 (B:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} aekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsve feemdildqgalqrlfkkysfmavihfaglkamgesvqkpldyyrvnltgtiqlleimka hgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwnvv llryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrdy ihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarre gdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgt
Timeline for d1i3kb_: