Lineage for d1i3ja_ (1i3j A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615547Fold d.285: DNA-binding domain of intron-encoded endonucleases [64495] (1 superfamily)
    beta(2)-alpha(2)-beta; 2 layers; 3-stranded antiparallel beta-sheet, order 213; HTH motif; also includes the extra N-terminal, DNA minor groove-binding helix
  4. 2615548Superfamily d.285.1: DNA-binding domain of intron-encoded endonucleases [64496] (1 family) (S)
  5. 2615549Family d.285.1.1: DNA-binding domain of intron-encoded endonucleases [64497] (2 proteins)
  6. 2615550Protein DNA-binding domain of intron endonuclease I-TevI [64498] (1 species)
    contains extra N-terminal zinc-finger domain
  7. 2615551Species Bacteriophage T4 [TaxId:10665] [64499] (2 PDB entries)
    Uniprot P13299 149-244
  8. 2615552Domain d1i3ja_: 1i3j A: [61594]
    protein/DNA complex; complexed with zn

Details for d1i3ja_

PDB Entry: 1i3j (more details), 2.2 Å

PDB Description: crystal structure of the dna-binding domain of intron endonuclease i-tevi with its substrate
PDB Compounds: (A:) intron-associated endonuclease 1

SCOPe Domain Sequences for d1i3ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3ja_ d.285.1.1 (A:) DNA-binding domain of intron endonuclease I-TevI {Bacteriophage T4 [TaxId: 10665]}
kfckcgvriqtsaytcskcrnrsgennsffnhkhsditkskisekmkgkkpsnikkiscd
gvifdcaadaarhfkissglvtyrvksdkwnwfyin

SCOPe Domain Coordinates for d1i3ja_:

Click to download the PDB-style file with coordinates for d1i3ja_.
(The format of our PDB-style files is described here.)

Timeline for d1i3ja_: