Lineage for d1i3ja_ (1i3j A:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 87504Fold e.30: DNA-binding domain of intron endonuclease I-TevI [64495] (1 superfamily)
  4. 87505Superfamily e.30.1: DNA-binding domain of intron endonuclease I-TevI [64496] (1 family) (S)
  5. 87506Family e.30.1.1: DNA-binding domain of intron endonuclease I-TevI [64497] (1 protein)
  6. 87507Protein DNA-binding domain of intron endonuclease I-TevI [64498] (1 species)
  7. 87508Species Bacteriophage T4 [TaxId:10665] [64499] (1 PDB entry)
  8. 87509Domain d1i3ja_: 1i3j A: [61594]

Details for d1i3ja_

PDB Entry: 1i3j (more details), 2.2 Å

PDB Description: crystal structure of the dna-binding domain of intron endonuclease i-tevi with its substrate

SCOP Domain Sequences for d1i3ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3ja_ e.30.1.1 (A:) DNA-binding domain of intron endonuclease I-TevI {Bacteriophage T4}
kfckcgvriqtsaytcskcrnrsgennsffnhkhsditkskisekmkgkkpsnikkiscd
gvifdcaadaarhfkissglvtyrvksdkwnwfyin

SCOP Domain Coordinates for d1i3ja_:

Click to download the PDB-style file with coordinates for d1i3ja_.
(The format of our PDB-style files is described here.)

Timeline for d1i3ja_: