Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.285: DNA-binding domain of intron-encoded endonucleases [64495] (1 superfamily) beta(2)-alpha(2)-beta; 2 layers; 3-stranded antiparallel beta-sheet, order 213; HTH motif; also includes the extra N-terminal, DNA minor groove-binding helix |
Superfamily d.285.1: DNA-binding domain of intron-encoded endonucleases [64496] (1 family) |
Family d.285.1.1: DNA-binding domain of intron-encoded endonucleases [64497] (2 proteins) |
Protein DNA-binding domain of intron endonuclease I-TevI [64498] (1 species) contains extra N-terminal zinc-finger domain |
Species Bacteriophage T4 [TaxId:10665] [64499] (2 PDB entries) Uniprot P13299 149-244 |
Domain d1i3ja_: 1i3j A: [61594] protein/DNA complex; complexed with zn |
PDB Entry: 1i3j (more details), 2.2 Å
SCOPe Domain Sequences for d1i3ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3ja_ d.285.1.1 (A:) DNA-binding domain of intron endonuclease I-TevI {Bacteriophage T4 [TaxId: 10665]} kfckcgvriqtsaytcskcrnrsgennsffnhkhsditkskisekmkgkkpsnikkiscd gvifdcaadaarhfkissglvtyrvksdkwnwfyin
Timeline for d1i3ja_: