Class b: All beta proteins [48724] (126 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) |
Family b.29.1.1: Legume lectins [49900] (4 proteins) |
Protein Concanavalin A [49901] (2 species) natural circle permutation: the "old" N- and C-termini are linked with a peptide bond,whereas the "new" ones correspond to a cleaved loop |
Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (45 PDB entries) |
Domain d1i3ha_: 1i3h A: [61592] complexed with dimannose complexed with ca, man, mn |
PDB Entry: 1i3h (more details), 1.2 Å
SCOP Domain Sequences for d1i3ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3ha_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis)} adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
Timeline for d1i3ha_: