SCOP 1.65: Domain d1i3ha_: 1i3h A:

Lineage for d1i3ha_ (1i3h A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Concanavalin A [49901] (2 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond,whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (45 PDB entries)

8. Domain d1i3ha_: 1i3h A: [61592]
   complexed with dimannose
   complexed with ca, man, mn

Details for d1i3ha_

PDB Entry: 1i3h, 1.2 Å

PDB Description: concanavalin a-dimannose structure

SCOP Domain Sequences for d1i3ha_:

Sequence; same for both SEQRES and ATOM records:

>d1i3ha_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d1i3ha_:

• d1i3ha_ first appeared in SCOP 1.57
  
• d1i3ha_ appears in SCOP 1.63
  
• d1i3ha_ appears in SCOP 1.67
  
• d1i3ha_ appears in the current release, SCOPe 2.08