Lineage for d1i3eb_ (1i3e B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759474Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries)
  8. 759478Domain d1i3eb_: 1i3e B: [61590]
    hemoglobin Bart's (gamma4)
    complexed with azi, hem

Details for d1i3eb_

PDB Entry: 1i3e (more details), 1.86 Å

PDB Description: human azido-met hemoglobin bart's (gamma4)
PDB Compounds: (B:) hemoglobin gamma chains

SCOP Domain Sequences for d1i3eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3eb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain [TaxId: 9606]}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh

SCOP Domain Coordinates for d1i3eb_:

Click to download the PDB-style file with coordinates for d1i3eb_.
(The format of our PDB-style files is described here.)

Timeline for d1i3eb_: