Class a: All alpha proteins [46456] (179 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (18 species) |
Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries) |
Domain d1i3eb_: 1i3e B: [61590] hemoglobin Bart's (gamma4) complexed with azi, hem |
PDB Entry: 1i3e (more details), 1.86 Å
SCOP Domain Sequences for d1i3eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3eb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain} ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk eftpevqaswqkmvtavasalssryh
Timeline for d1i3eb_: