Lineage for d1i3ea_ (1i3e A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 349705Protein Hemoglobin, beta-chain [46500] (19 species)
  7. 349993Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries)
  8. 349996Domain d1i3ea_: 1i3e A: [61589]

Details for d1i3ea_

PDB Entry: 1i3e (more details), 1.86 Å

PDB Description: human azido-met hemoglobin bart's (gamma4)

SCOP Domain Sequences for d1i3ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3ea_ a.1.1.2 (A:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh

SCOP Domain Coordinates for d1i3ea_:

Click to download the PDB-style file with coordinates for d1i3ea_.
(The format of our PDB-style files is described here.)

Timeline for d1i3ea_: