Lineage for d1i3ea_ (1i3e A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 148233Family a.1.1.2: Globins [46463] (18 proteins)
  6. 148338Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 148386Species Human (Homo sapiens) [TaxId:9606] [46487] (81 PDB entries)
  8. 148438Domain d1i3ea_: 1i3e A: [61589]
    Other proteins in same PDB: d1i3eb_

Details for d1i3ea_

PDB Entry: 1i3e (more details), 1.86 Å

PDB Description: human azido-met hemoglobin bart's (gamma4)

SCOP Domain Sequences for d1i3ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3ea_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh

SCOP Domain Coordinates for d1i3ea_:

Click to download the PDB-style file with coordinates for d1i3ea_.
(The format of our PDB-style files is described here.)

Timeline for d1i3ea_: