SCOP 1.73: Domain d1i3db_: 1i3d B:

Lineage for d1i3db_ (1i3d B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (22 species)

7. Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries)

8. Domain d1i3db_: 1i3d B: [61588]
   hemoglobin Bart's (gamma4)
   complexed with cmo, hem

Details for d1i3db_

PDB Entry: 1i3d, 1.7 Å

PDB Description: human carbonmonoxy hemoglobin bart's (gamma4)

PDB Compounds: (B:) hemoglobin gamma chains

SCOP Domain Sequences for d1i3db_:

Sequence; same for both SEQRES and ATOM records:

>d1i3db_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain [TaxId: 9606]}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh

Timeline for d1i3db_:

• d1i3db_ first appeared in SCOP 1.57
  
• d1i3db_ appears in SCOP 1.71
  
• d1i3db_ appears in SCOP 1.75
  
• d1i3db_ appears in the current release, SCOPe 2.08