![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (22 species) |
![]() | Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries) |
![]() | Domain d1i3db_: 1i3d B: [61588] hemoglobin Bart's (gamma4) complexed with cmo, hem |
PDB Entry: 1i3d (more details), 1.7 Å
SCOP Domain Sequences for d1i3db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3db_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain} ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk eftpevqaswqkmvtavasalssryh
Timeline for d1i3db_: