Lineage for d1i3db_ (1i3d B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44242Protein Hemoglobin, beta-chain [46500] (16 species)
  7. 44430Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries)
  8. 44431Domain d1i3db_: 1i3d B: [61588]
    Other proteins in same PDB: d1i3da_

Details for d1i3db_

PDB Entry: 1i3d (more details), 1.7 Å

PDB Description: human carbonmonoxy hemoglobin bart's (gamma4)
PDB Compounds: (B:)

SCOP Domain Sequences for d1i3db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3db_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh

SCOP Domain Coordinates for d1i3db_:

Click to download the PDB-style file with coordinates for d1i3db_.
(The format of our PDB-style files is described here.)

Timeline for d1i3db_: