Lineage for d1i3aa_ (1i3a A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 701967Family c.55.3.1: Ribonuclease H [53099] (4 proteins)
  6. 701982Protein Class II ribonuclease H (RNase HII) [53103] (5 species)
  7. 701983Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [64093] (2 PDB entries)
  8. 701985Domain d1i3aa_: 1i3a A: [61586]
    complexed with nco

Details for d1i3aa_

PDB Entry: 1i3a (more details), 2.15 Å

PDB Description: rnase hii from archaeoglobus fulgidus with cobalt hexammine chloride
PDB Compounds: (A:) ribonuclease hii

SCOP Domain Sequences for d1i3aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3aa_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte
vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl
rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias
gripscvrmrwktvsnlrqk

SCOP Domain Coordinates for d1i3aa_:

Click to download the PDB-style file with coordinates for d1i3aa_.
(The format of our PDB-style files is described here.)

Timeline for d1i3aa_: