![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (9 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
![]() | Protein Class II ribonuclease H (RNase HII) [53103] (3 species) |
![]() | Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [64093] (2 PDB entries) |
![]() | Domain d1i3aa_: 1i3a A: [61586] complexed with nco |
PDB Entry: 1i3a (more details), 2.15 Å
SCOP Domain Sequences for d1i3aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3aa_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Archaeoglobus fulgidus} mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias gripscvrmrwktvsnlrqk
Timeline for d1i3aa_: