Lineage for d1i3aa_ (1i3a A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) 
Family c.55.3.1: Ribonuclease H [53099] (3 proteins) 
Protein Class II ribonuclease H (RNase HII) [53103] (3 species) 
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [64093] (2 PDB entries) 
Domain d1i3aa_: 1i3a A: [61586]
Details for d1i3aa_
PDB Entry: 1i3a (more details), 2.15 Å
PDB Description: rnase hii from archaeoglobus fulgidus with cobalt hexammine chloride
SCOP Domain Sequences for d1i3aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3aa_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Archaeoglobus fulgidus}
mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte
vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl
rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias
gripscvrmrwktvsnlrqk
SCOP Domain Coordinates for d1i3aa_:
Click to download the PDB-style file with coordinates for d1i3aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i3aa_:
- d1i3aa_ is new in SCOP 1.57
- d1i3aa_ appears in SCOP 1.59
- d1i3aa_ appears in the current release, SCOPe 2.08
View in 3D