SCOP 1.63: Domain d1i39a_: 1i39 A:

Lineage for d1i39a_ (1i39 A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein Class II ribonuclease H (RNase HII) [53103] (3 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [64093] (2 PDB entries)

8. Domain d1i39a_: 1i39 A: [61585]

Details for d1i39a_

PDB Entry: 1i39, 1.95 Å

PDB Description: rnase hii from archaeoglobus fulgidus

SCOP Domain Sequences for d1i39a_:

Sequence; same for both SEQRES and ATOM records:

>d1i39a_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Archaeoglobus fulgidus}
mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte
vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl
rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias
gripscvrmrwktvsnlrqk

Timeline for d1i39a_:

• d1i39a_ first appeared in SCOP 1.57
  
• d1i39a_ appears in SCOP 1.61
  
• d1i39a_ appears in SCOP 1.65
  
• d1i39a_ appears in the current release, SCOPe 2.08