Lineage for d1i38a_ (1i38 A:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (14 proteins) 
Protein Androgen receptor [63621] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [63622] (2 PDB entries) 
Domain d1i38a_: 1i38 A: [61584]
Details for d1i38a_
PDB Entry: 1i38 (more details), 2 Å
PDB Description: crystal structure of the rat androgen receptor ligand binding domain t877a mutant complex with dihydrotestosterone
SCOP Domain Sequences for d1i38a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i38a_ a.123.1.1 (A:) Androgen receptor {Rat (Rattus norvegicus)}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpts
csrrfyqltklldsvqpiarelhqfafdllikshmvsvdfpemmaeiisvqvpkilsgkv
kpiyfht
SCOP Domain Coordinates for d1i38a_:
Click to download the PDB-style file with coordinates for d1i38a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i38a_:
- d1i38a_ is new in SCOP 1.57
- d1i38a_ appears in SCOP 1.59
- d1i38a_ appears in the current release, SCOPe 2.08
View in 3D