Lineage for d1i38a_ (1i38 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728287Protein Androgen receptor [63621] (4 species)
  7. 2728368Species Norway rat (Rattus norvegicus) [TaxId:10116] [63622] (6 PDB entries)
  8. 2728372Domain d1i38a_: 1i38 A: [61584]
    complexed with dht; mutant

Details for d1i38a_

PDB Entry: 1i38 (more details), 2 Å

PDB Description: crystal structure of the rat androgen receptor ligand binding domain t877a mutant complex with dihydrotestosterone
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d1i38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i38a_ a.123.1.1 (A:) Androgen receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpts
csrrfyqltklldsvqpiarelhqfafdllikshmvsvdfpemmaeiisvqvpkilsgkv
kpiyfht

SCOPe Domain Coordinates for d1i38a_:

Click to download the PDB-style file with coordinates for d1i38a_.
(The format of our PDB-style files is described here.)

Timeline for d1i38a_: