Lineage for d1i2ta_ (1i2t A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51613Fold a.144: PABC (PABP) domain [63569] (1 superfamily)
  4. 51614Superfamily a.144.1: PABC (PABP) domain [63570] (1 family) (S)
  5. 51615Family a.144.1.1: PABC (PABP) domain [63571] (2 proteins)
  6. 51616Protein hyperplastic discs protein [63574] (1 species)
  7. 51617Species Human (Homo sapiens) [TaxId:9606] [63575] (1 PDB entry)
  8. 51618Domain d1i2ta_: 1i2t A: [61582]

Details for d1i2ta_

PDB Entry: 1i2t (more details), 1.04 Å

PDB Description: x-ray structure of the human hyperplastic discs protein: an ortholog of the c-terminal domain of poly(a)-binding protein

SCOP Domain Sequences for d1i2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i2ta_ a.144.1.1 (A:) hyperplastic discs protein {Human (Homo sapiens)}
hrqalgerlyprvqamqpafaskitgmllelspaqlllllasedslrarvdeameliiah
g

SCOP Domain Coordinates for d1i2ta_:

Click to download the PDB-style file with coordinates for d1i2ta_.
(The format of our PDB-style files is described here.)

Timeline for d1i2ta_: