Lineage for d1i2md_ (1i2m D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114239Fold b.69: 7-bladed beta-propeller [50964] (9 superfamilies)
  4. 114309Superfamily b.69.5: RCC1/BLIP-II [50985] (2 families) (S)
  5. 114310Family b.69.5.1: Regulator of chromosome condensation RCC1 [50986] (1 protein)
  6. 114311Protein Regulator of chromosome condensation RCC1 [50987] (1 species)
  7. 114312Species Human (Homo sapiens) [TaxId:9606] [50988] (2 PDB entries)
  8. 114317Domain d1i2md_: 1i2m D: [61571]
    Other proteins in same PDB: d1i2ma_, d1i2mc_

Details for d1i2md_

PDB Entry: 1i2m (more details), 1.76 Å

PDB Description: ran-rcc1-so4 complex

SCOP Domain Sequences for d1i2md_:

Sequence, based on SEQRES records: (download)

>d1i2md_ b.69.5.1 (D:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens)}
kvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtvcls
ksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrvflw
gsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcgeqgq
lgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcgayftfaisheghvyg
fglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgraey
grlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtgqde
dawspvemmgkqlenrvvlsvssggqhtvllvkdke

Sequence, based on observed residues (ATOM records): (download)

>d1i2md_ b.69.5.1 (D:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens)}
kvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtvcls
ksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrvflw
gsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcgeqgq
lgrvpelfanrggrqglerllvpkcvmlkhvrfqdafcgayftfaisheghvygfglsny
hqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgraeygrlglg
egaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtgqdedawspv
emmgkqlenrvvlsvssggqhtvllvkdke

SCOP Domain Coordinates for d1i2md_:

Click to download the PDB-style file with coordinates for d1i2md_.
(The format of our PDB-style files is described here.)

Timeline for d1i2md_: